Lethal Weapon 2
1989
Comedy, Suspense/Thriller
1h 54m
Riggs and Murtaugh are on the trail of South African diplomats who are using their immunity to engage in criminal activities. (imdb)
Directed by:
Franchise:
Genres:
Country:
Your probable score
?
Lethal Weapon 2
1989
Comedy, Suspense/Thriller
1h 54m
Your probable score
Avg Percentile 49.23% from 5079 total ratings
Ratings & Reviews
(5079)
Compact view
Compact view
Show
Sort
Rated 27 Apr 2014
64
45th
This was the movie that caused me to fall in love with Patsy Kensit; a love that would carry me to watch exactly zero more good movies.
Rated 27 Apr 2014
Rated 03 Dec 2013
3
38th
I'm not sure why people think this is some substantial dropoff from the first. Joe Pesci plays an annoying character that manages to be amusing instead of grating, and it's about the same as the first otherwise without being a shameless rehash. Also, it's weird to watch this 25 years after the fact and realize where GTA5 got that whole "Tearing down a house on the hill with a truck" idea from.
Rated 03 Dec 2013
Rated 20 Jul 2010
60
12th
Just like the first it's ridiculous and nonsensical, but not enough to be over the top fun. At the same time it's not totally mindless so it's watchable, just very forgettable.
Rated 20 Jul 2010
Rated 18 Jan 2010
69
76th
The fall of apartheid has deprived us of a crop of hilariously accented modern day Nazis to serve as stock villains in our media.
Rated 18 Jan 2010
Rated 17 May 2014
71
44th
I felt like I was watching Cosby Show reruns guest starring some psycho, mullet-wearing cokehead. Then Joe Pesci showed up and I found myself eagerly anticipating a commercial break.
Rated 17 May 2014
Rated 14 Aug 2007
55
19th
Lethal Weapon is one of those series where I know I've seen at least two of the movies, but I can't remember exactly which ones (the Rocky series is another example). I think this is one of the ones I've seen. What am I basing the score on if that's how little I remember about the film? I'm not sure. I guess I've just ranked it so it looks like I've seen more movies. Plus, I expect this is more or less how I'd feel about it, going by what I do remember.
Rated 14 Aug 2007
Rated 14 Aug 2007
72
34th
"grab the cat!" This the sterotype that all other buddy copy movies (now) try to emulate, I would say that this emulates the 48 hours template or rather the 1st one did. Joe Pesci is great as Leo Getz, and remember never talk to your boss while standing on top of painter's plastic.
Rated 14 Aug 2007
Rated 04 May 2007
100
95th
Like all Richard Donner movies, about as subtle as a brick... but has that unique quality of having heightened silliness yet heightened intensity at film's end
Rated 04 May 2007
Rated 21 Jun 2013
70
54th
Sax + guitar = suspense
Rated 21 Jun 2013
Rated 05 Feb 2017
8
93rd
I have to imagine any Lethal Weapon fans seeing this back in '89 were enormously satisfied. It is the true sequel that ups the scale and the stakes and the action on every level while remaining true to the spirit of the first. Bomb on the toilet, helicopter beach shootout, collapsing stilt house, final dock/ship showdown, all great set pieces. Gibson and Glover continue to deliver in their chemistry. 80s action greatness!
Rated 05 Feb 2017
Rated 24 Oct 2019
60
72nd
Most memorable line...Joe Peschi giving them advice about the drive thru that they should always order at the counter because they fuck you at the drive thru...Which is true...Also bad guy saying diplomatic immunity laughing so hard mocking the cops and Danny Glover just shoots him anyways saying it's just been revoked.
Rated 24 Oct 2019
Rated 07 Jan 2023
80
75th
I didn't think they could top the toilet bowl bomb, but they followed it up with the slo-mo woman flipping through the air after a diving board bomb. Top tier stuff. Riggs sure loves to run after cars.
Rated 07 Jan 2023
Rated 08 Oct 2007
80
80th
The dual Gibson and Glover is sensational, it seems that were made for each other. Good as the first. And Pesci was very funny too.
Rated 08 Oct 2007
Rated 18 Aug 2011
82
80th
Totally appropriate sequel. Its not as streamlined as the first in its pacing, but it has a story that's larger in scope, more character moments, and more action( even if its not as visceral as its predecessor). It delivers all you would want from a sequel and having just introduced pesci he works as extra comic relief rather than the grating nuisance he would become.
Rated 18 Aug 2011
Rated 09 Aug 2017
70
62nd
Way more fun to watch than the original, which had an awkward blend of humorous and super bleak moments. Gibson's character is way more likable, it's funnier, the action is better (if for no other reason, then simply by virtue of not being sans lighting), and I liked how they sensibly avoided the family being the main targets while still keeping it dramatic. The villains kinda suck, but Pesci and the love interest are interesting additions.
Rated 09 Aug 2017
Rated 26 Apr 2009
64
36th
This takes everything that was so good about the first film, and turns it on it's head. I couldn't finish this movie because of how disgusted I was. While the original had some real character development, it feels like the story was finished, and the characters were as well. There is no build up here, and the characters suffer from sequel staleness. In 1989 this might have been a great movie, but it did not age well now that the "Buddy Cop" genre is relatively established.
Rated 26 Apr 2009
Rated 24 Sep 2009
80
74th
glover and gibson make an excellent team, and i love their characters. it's a bit on the long winded side, but packed with plenty of action and clever dialog.
Rated 24 Sep 2009
Rated 14 Aug 2007
55
32nd
Extremely formulaic 80's cop/buddy movie. Enjoyable if mostly predictable.
Rated 14 Aug 2007
Rated 14 Apr 2008
100
93rd
"I WAS UP WITH YOUR BOSS, SHOOTIN THE BREEZE....SHOOTIN HIS FISH
Rated 14 Apr 2008
Rated 25 Sep 2010
69
73rd
You thought he was getting too old for this shit before!? The entire series is idiotic but its entertaining idiocy. Spawned the now famous and often reused, "Diplomatic Immunity!"
Rated 25 Sep 2010
Rated 07 Dec 2006
48
44th
More of the same; fortunately, "the same" is very good. Still, lacks the intensity of the first or the wit of the 3rd.
Rated 07 Dec 2006
Rated 04 Nov 2009
67
32nd
It wasn't nearly as good as I remembered it being. I remembered cracking up at numerous points the first time around- during Joe Pesci's scenes, the bathroom sequence- but this time I didn't manage much more than a few chuckles. There are some good action sequences here, but I found myself bored by the time I hit the final act.
Rated 04 Nov 2009
Rated 26 May 2012
70
75th
I liked all the lethal weapon movies most movies about cops are shit this one is always good.
Rated 26 May 2012
Rated 09 Nov 2008
70
36th
a 60 score, unless you like cheesy buddy flicks where cliche's and puns abound. Like me.
Rated 09 Nov 2008
Rated 28 Sep 2008
85
55th
Not the best Lethal Weapon, rockin' nonetheless.
Rated 28 Sep 2008
Rated 10 Mar 2024
60
69th
The toilet bomb was one of my dad's favourite movie scenes. The dead girl underwater freaked me out as a kid. Decent action flick with some humour.
Rated 10 Mar 2024
Rated 03 Jan 2018
84
64th
A terrific follow up to an equally terrific film. Gibson and Glover still work incredibly well together to service a story which raises the stakes in every way a sequel should. Hats off to capping off the emotional story points left over in the original film for good in a genuinely satisfying way. Not all sequels are capable of doing.
Rated 03 Jan 2018
Rated 18 Dec 2010
85
55th
+ GOOD: Gibson didn't act too over-the-top like the first one, played a good mix of crazy and professional, good chemistry again with the two of them, action was good (if not fake at times), music not as bad as the first ; - BAD: Too much of a retread, Joe Pesci is annoying, bad guys too stereotypical, message too hit over the head, villain backstory could've been done better, music still overbearing
Rated 18 Dec 2010
Rated 21 Apr 2007
75
32nd
I liked this one more than the first. There's more action and Danny Glover proves he can act. Gibson is funnier and Pesci is an enjoyable little scamp.
Rated 21 Apr 2007
Rated 14 Aug 2007
81
71st
Almost as good as the first one. Just enough cliche without going over the top. Again, the series will continue to decline from this point.
Rated 14 Aug 2007
Rated 04 Jul 2010
4
63rd
🧑🏻: "diplomatic immunity!"🧑🏻💥🔫👴🏾:"just been revoked
Rated 04 Jul 2010
Rated 10 Nov 2011
68
46th
Not quite as good as the first movie but still very good. And the "IT'S JUST BEEN REVOKED" line is brilliant.
Rated 10 Nov 2011
Rated 13 Aug 2014
65
47th
A small downgrade from the original classic buddy-cop. Focusing more on humor than action and story, the sequel loses some of the character development and charm. Yet, even still Glover and Gibson are fantastic and carry this movie. Diplomatic Immunity indeed.
Rated 13 Aug 2014
Rated 31 Jul 2009
81
86th
A shit load of fun crammed into a couple of hours. I love the Leathal Weapon series and to be honest I enjoy this one just as much as the first. "DIPLOMATIC IMMUNITY!"
Rated 31 Jul 2009
Rated 03 May 2011
80
51st
Eric Clapton wrote the score for all the lethal weapon films. That alone will score it a solid 80. I also can't decide weather gibson is better with or without the mullet. The anti-Semitism, however, is definitely a win.
Rated 03 May 2011
Rated 07 Sep 2007
86
89th
An excellent action-sequel to the original hit. It's very explosive, very funny, very high-tempered, and the addition of Joe Pesci works so well.
Rated 07 Sep 2007
Rated 14 Aug 2007
2
63rd
A fun sequel. Donner and Black made two movies about goofy, invincible supercops and they're good enough that you can watch them and not feel like you got punched in the brain. That is a rare thing.
Rated 14 Aug 2007
Rated 08 Jan 2012
80
86th
8- highly recommended, great
Rated 08 Jan 2012
Rated 30 Jul 2015
80
57th
This weapon wasn't 2 lethal but I still enjoyed it. I must say my biggest problem with it was Joe Pesci. Okay, okay, okay... I know, that's he's Hollywood schtick but he still bothered me, at least until he manned up a bit towards the end of the film. Riggs and Murtaugh are still the ultimate buddy cops. The scene on the toilet almost had me in tears with laughter. Patsy Kensit was stunning as the South African consulate girl. I would like to see more movies with her in it...
Rated 30 Jul 2015
Rated 21 Dec 2011
67
20th
This movie has some funny scenes but the action sequences are nothing special. The love subplot is also very ho hum. Overall this is a very average piece of entertainment.
Rated 21 Dec 2011
Rated 19 Jan 2014
50
47th
I find it difficult to recommend Lethal Weapon 2 for a couple of reasons. The first is the difference in tone from the original. It balanced the comedy and thrills, while this one leans far toward the former. The second is the inclusion of Joe Pesci, who becomes irritating by the film's conclusion. The action is still good and the scenes involving just Glover and Gibson are great, but the film around these two elements isn't up to snuff.
Rated 19 Jan 2014
Rated 16 Feb 2010
60
30th
Mel Gibson is back and with even more angst. I barely remember this one because the villains were completely dumb. This is as generic of a sequel as they come and there's little difference between Lethal Weapon 2 and 1. It's mindless but not terrible or boring.
Rated 16 Feb 2010
Rated 25 Feb 2023
73
47th
audiovisual 75 acting 72 overall feeling 72 avg 71
Rated 25 Feb 2023
Rated 25 Apr 2008
70
53rd
* Diplomatic immunity!" - Minister of Diplomatic Affairs Arjen Rudd "It's just been revoked!" - replies Murtaugh, after shooting him in the head
Rated 25 Apr 2008
Rated 22 Feb 2010
84
43rd
Who can turn down a Lethal Weapon, especially one with a surfboard impaling a fleeing criminal?
Rated 22 Feb 2010
Rated 09 Aug 2012
90
52nd
Rare that a sequel is as good or better. They built on the chemistry of the two leads and got a bonus with Joe Pesci comedy relief!
Rated 09 Aug 2012
Rated 04 Feb 2018
70
60th
Fun. Mel and Danny are a good pair. Very entertaining.
Rated 04 Feb 2018
Rated 12 Jul 2007
83
31st
Not as good as the first, but not yet descended into utter crappiness.
Rated 12 Jul 2007
Rated 31 Jan 2017
80
63rd
Lethal Weapon 2 might have been the first movie that brought the plight of aparteid to my conscious. During the first 20 years of my life this movie was the only representation of South Africa for me. I know how bad that sounds but it also shows how much of an impact movies and TV played in the daily lives of Americans before the internet. In this second outing, Riggs and Murtaugh are joined by Joe Pesci who plays an informant that the duo need to protect. It is another classic in the series.
Rated 31 Jan 2017
Rated 04 Dec 2008
22
18th
A few interesting and amusing moments.
Rated 04 Dec 2008
Rated 18 Jan 2007
70
37th
not bad for a sequal
Rated 18 Jan 2007
Rated 23 Dec 2008
75
44th
On par with the first movie. Very 80's, but very cool.
Rated 23 Dec 2008
Rated 01 Feb 2008
20
15th
Story goes on nicely from the first, but this one is in the end even worser than the first one. Mel Gibson is pretty mixture of batman and joker. And I'm talking about that dark knight version! The bad guys are ludicrous. This movie includes several familiar faces, for example Joe Pesci and Patsy Kensit. And this time Mel is not the only one who's butt naked.
Rated 01 Feb 2008
Rated 26 Feb 2007
45
25th
Poor.
Rated 26 Feb 2007
Rated 03 Jul 2009
80
70th
It's no Lethal Weapon, but there is plenty of action and it makes for a suitably entertaining film, and the leads are still great.
Rated 03 Jul 2009
Rated 11 Jul 2012
75
85th
If the first film channeled 48Hrs. then this one channeled Beverly Hills Cop. I actually liked the bad guy in this one better and the whole thing is faster paced. Another plus is the fact that both actors are more comfortable in their roles. The main story isn't as good and there are plenty of giant plot holes but it's big, loud and fun.
Rated 11 Jul 2012
Rated 22 Mar 2008
57
12th
A promising buddy team in the original picture, the main characters begin their descent into caricature in this remake.
Rated 22 Mar 2008
Rated 22 Jun 2011
60
16th
"South African Diplomat Suspected Drug Kingpin!" That single headline could have shortened the movie to under an hour and saved half a dozen lives.
Rated 22 Jun 2011
Rated 24 Jan 2017
76
65th
Does the job as a solid sequel but not much else. Has a few funny bits. The diplomat angle was not really exploited and the romance was a bit strange. Joe Pesci is fairly likeable though. Could have done with more family time and a proper conclusion for the wife's car.
Rated 24 Jan 2017
Rated 15 Aug 2009
99
98th
DIPLOMATIC IMMUNITY! Danny Glover cracks his black neck, shoots him in the head and says: "It's just been revoked."
Rated 15 Aug 2009
Rated 23 Aug 2009
97
92nd
As good as the original.
Rated 23 Aug 2009
Rated 12 Sep 2008
40
23rd
Very dated crap that relied too much on slapstick humor and quips. I don't understand why a consulate would flout diplomatic immunity. Then again, if the writers knew that a consular officer could be arrested for felonies, that would shatter the already razor thin plot of this crap. Also, why were LAPD assigned to protect a federal witness? Wouldn't that fall under the jurisdiction of either the US Marshals or FBI? And who did the porno-music soundtrack?
Rated 12 Sep 2008
Rated 14 Aug 2007
88
68th
An adventurous sequel that is almost as much fun as the first.
Rated 14 Aug 2007
Rated 01 Jan 2011
50
18th
Yet another disappointing summer sequel, Lethal Weapon 2, with Danny Glover and Mel Gibson reprising their cop-buddy roles in pursuit of South African drug lords.
Rated 01 Jan 2011
Rated 25 Feb 2008
85
74th
the father of all buddy movies. quite funny with many cool action scenes.
Rated 25 Feb 2008
Rated 27 Jan 2010
70
14th
Significantly dumber than the original.
Rated 27 Jan 2010
Rated 20 Dec 2013
83
61st
Lethal Weapon 2 may sport a thin plot typical of action fare, but its combination of humor and adrenaline, along with the chemistry between its leads, make this a playful, entertaining sequel.
Rated 20 Dec 2013
Rated 30 Jun 2013
100
90th
Over the top and "stupid", but so much fun I have to love it. One of the great 80s sequels.
Rated 30 Jun 2013
Rated 26 Aug 2014
80
50th
The same and equal band of talent follow up with characters who go from being fans of the 3 Stooges to actually being the 3 Stooges, even going as far as to include Joe Pesci as the third-wheel butt of their jokey aggravation (incidentally showing his striking range). And yet the film keeps you on its toes by also being equally as brutal as the original and even more bittersweet.
Rated 26 Aug 2014
Rated 20 Mar 2009
70
71st
Contains one of my favorite lines in movies ever: "Roger: I'm gonna die on a toilet, aren't I? Riggs: Guys like you don't die on toilets."
Rated 20 Mar 2009
Rated 14 Aug 2007
84
85th
Love all these...wish they'd make more
Rated 14 Aug 2007
Rated 22 Nov 2013
8
76th
Lethal Weapon 2 is a solid sequel and personally I think it's on a par with it's predecessor. Gibson & Glover are great together once again and their characters and relationship has developed further. And the inclusion of hilarious side kick Joe Pesci offers even more comic relief. I actually didn't mind Patsy Kensit here either. Michael Kamen's score in this particular installment is a worthy mention also. The mix of of action and humour make this a worthy addition in the Lethal Weapon series.
Rated 22 Nov 2013
Rated 10 Jun 2009
70
59th
Glover still not to old for this shit, apparently. They never bettered the 1st one, though.
Rated 10 Jun 2009
Rated 01 Jul 2008
87
62nd
Not as good as the first or the fourth, but much better than number three and still a really good film.
Rated 01 Jul 2008
Rated 14 Aug 2007
80
60th
DIPLOMATIC IMMUNITY!!!!
Rated 14 Aug 2007
Rated 23 Jun 2018
90
64th
As good as the first, but with a little more emphasis on comedy rather than some of the more serious aspects of the first. Honestly this works pretty well as the chemistry between Gibson and Glover is great. This doesn't dial down the action as it's still true to the 80s action movie form. Pesci is a bit annoying and the romance is okay but feels a bit shoehorned in. Overall if you're up for an 80s action movie with shooting, explosions and car chases you don't need to look further.
Rated 23 Jun 2018
Rated 02 Feb 2020
60
44th
The humour factor is stronger in this, the first sequel of "Lethal Weapon", partly thanks to an on-fire Joe Pesci, something that makes for a welcome variation in tone. Elsewhere, we are once again treated to an uneven mix of mostly solid action and rather simplistic writing.
Rated 02 Feb 2020
Rated 30 Dec 2021
60
18th
In my memories from childhood/youth interchangeable with the first LW. LW2 is, however, much weaker. Riggs-Murtaugh are still a good combo, but most of the heart, of the atmosphere, of the attention to detail of the original has been replaced by silly humor and silly action set pieces. Leo Getz symbolizes the direction chosen for the franchice. Somewhat disappointing, but still a highly entertaining action classic.
Rated 30 Dec 2021
Rated 16 Aug 2022
55
57th
Lethal Weapon 2 is another solid action buddy-cop movie with even more detectives who are too old for this. It's not anything terribly special but it just refuses to be normal even when following genre convention. In short, it's got diplomatic immunity.
Rated 16 Aug 2022
Rated 11 May 2022
60
26th
Daughtercondomcommerciallol+okaythenLsavesitlol+theyfuckyouatthedrivethru+toiletbomblol+goonkilledhiswifetrynakillhim-killednewgf+i’mnotacoptonight+idunnoifMkeptthedirtymoneylolkindadidntpayattention
Rated 11 May 2022
Rated 11 Jun 2022
85
90th
Sam the Dog steals the show. I wish they did a spin-off movie just on him being lethal to rabbits.
Rated 11 Jun 2022
Rated 02 Jul 2022
50
35th
ger; [lethal weapon 2: Brennpunkt L.A.]; ein krimineller von Südafrika hält die Polizei auf Trab - doch die zwei Polizisten drehen das Spiel um und sorgen für einigen Ärger bei dem Diplomat.
Rated 02 Jul 2022
Rated 01 Aug 2022
90
88th
Diplomatic Immunity!!!
Rated 01 Aug 2022
Cast & Info
Directed by:
Franchise:
Genres:
Country:
Collections
(28)
Compact view
Show
Sort
Moderated by Pickpocket
Last updated on with W.E.
Moderated by Gregzilla
Last updated on with Teacher's Pet
Moderated by kubricksucks
Last updated on with Road House
Moderated by BeeDub
Last updated on with Kung Fu Panda 4
Moderated by td888
Last updated on with Kindergarten Cop 2
Moderated by PeaceAnarchy
Last updated on with Faraway Downs
Moderated by fanfic
Last updated on with The Last Witch Hunter
Moderated by afx237vi
Last updated on with The Loneliest Planet
Moderated by fanfic
Last updated on with Babylon A.D.
Moderated by QuickyAPI
Last updated on with Ice Age: Continental Drift
Moderated by PerryStroika
Last updated on with Rye Lane
Moderated by TonyS.
Last updated on with Pig, the Snake and the Pigeon
Moderated by TV+Film-Hub
Last updated on with Constantine
Moderated by nahuelgl
Last updated on with Garuda Power: The Spirit Within
Moderated by Ag0stoMesmer
Last updated on with Hearts & Minds
Moderated by cyrax_36
Last updated on with The Shining
Moderated by juglar103
Last updated on with Winter's Bone
Moderated by polanski28
Last updated on with The Seventh Continent
Moderated by td888
Last updated on with Bakersfield P.D.
Moderated by ribcage
Last updated on with 300: Rise of an Empire
Moderated by elhenzo
Last updated on with Made of Honor
Moderated by SageSledge
Last updated on with Sinbad: Legend of the Seven Seas
Showing 1 - 24 of 28 results
Similar Titles
Loading ...
Statistics
Loading ...
PSI
?